LL-37

Buy LL-37 Online in the USA

LL-37 is a naturally occurring antimicrobial peptide that plays a vital role in the human body’s innate immune defense system. It belongs to the family of cathelicidin peptides and is produced by various cells, including white blood cells and epithelial cells. Discovered as part of the body’s first line of defense against pathogens, LL-37 helps protect against bacterial, viral, and fungal infections.

Biologically, LL-37 performs several key functions. It not only neutralizes harmful microorganisms but also modulates immune responses, reduces inflammation, and promotes tissue repair and wound healing. Its multifunctional nature makes it an area of growing interest among researchers studying immune modulation, chronic wounds, and inflammatory diseases.

In recent years, LL-37 has gained increasing popularity in peptide therapy and biomedical research across the USA. Scientists and clinicians are exploring its potential therapeutic applications in treating infections, autoimmune disorders, and even certain cancers. As peptide research continues to expand, antimicrobial peptide stands out as one of the most studied and promising peptides for advancing immune-related treatments and regenerative medicine.

Why Researchers Choose LL-37

Researchers are increasingly drawn to LL-37 because of its broad therapeutic potential and multifaceted biological activity. As a naturally occurring peptide with strong antimicrobial and immunomodulatory properties, LL-37 serves as a valuable model for developing new treatment approaches in infection control, wound care, and immune regulation.

One of the main reasons scientists study antimicrobial peptide is its dual mechanism of action. First, it directly destroys pathogens by disrupting bacterial membranes, making it a potent antimicrobial agent against both Gram-positive and Gram-negative bacteria, as well as some viruses and fungi. Second, it influences the immune system by modulating inflammatory responses, helping balance the body’s defense mechanisms without triggering excessive inflammation. This immunoregulatory role positions LL-37 as an important candidate for therapies aimed at chronic inflammatory or autoimmune conditions.

Key Features & Research Applications

🦠 Broad Antimicrobial Spectrum

LL-37 demonstrates potent antimicrobial activity against a wide range of pathogens, including Gram-positive and Gram-negative bacteria, certain fungal species, and enveloped viruses. Its mechanism of action involves disruption of microbial membranes and neutralization of bacterial components such as lipopolysaccharides (LPS) and lipoteichoic acids (LTA), making it highly valuable in infection-related research models.

🧫 Anti-Biofilm Activity

This peptide effectively interferes with biofilm formation and helps disperse existing biofilms, offering important insights into chronic and persistent infections. Antimicrobial peptide is often used in studies focused on bacterial resistance and the development of anti-biofilm therapeutics.

🛡️ Immunomodulation

LL-37 plays a central role in immune system modulation, influencing cytokine production and regulating inflammatory signaling. It exhibits chemotactic activity, particularly through the FPR2 (Formyl Peptide Receptor 2) pathway, making it a valuable molecule for investigating innate and adaptive immune crosstalk.

🩹 Wound & Epithelial Repair

Research shows LL-37 can significantly enhance tissue regeneration by promoting re-epithelialization, angiogenesis, and barrier restoration in both skin and mucosal models. These properties have made LL-37 an important focus in studies of wound healing, tissue remodeling, and regenerative medicine.

🌬️ Mucosal Defense Research

LL-37 is extensively evaluated in respiratory, oral, gastrointestinal, and urogenital models for its role in host-pathogen interactions and barrier protection. Its broad activity across mucosal systems highlights its potential for developing new therapeutic strategies in infection prevention and immune health.

---

Product Details

Name: LL-37 (Human Cathelicidin)
Form: Lyophilized powder
Amino Acid Sequence (37 aa): [LL-37, 37 aa]
Molecular Weight: ~4,493 Da
Purity: ≥ 98% (HPLC-verified)
Dosage Strength: 5 mg per vial
Appearance: White to off-white lyophilized powder

Storage Conditions:
Store the dry powder at 2–8 °C (35.6–46.4 °F). After reconstitution, aliquot and freeze at −20 °C (−4 °F) to avoid repeated freeze-thaw cycles. Protect from light and moisture at all times.

Solubility:
Easily soluble in sterile water or mild aqueous buffers with gentle agitation.

Packaging:
Sterile, sealed research-grade vial designed for laboratory use.

Verification:
Each batch is third-party tested for identity and purity, with full analytical documentation available upon request.

Buy LL-37 Online in the USA: Trusted Source

When it comes to purchasing LL-37 peptides for research, one of the most trusted and reputable suppliers in the United States is LeoLabRx.com. The company has earned a strong reputation among researchers for providing high-quality, laboratory-grade peptides that meet strict manufacturing and purity standards.

LeoLabRx specializes in producing peptides exclusively for research and laboratory use, ensuring that each product undergoes rigorous testing and quality control before being made available for purchase. Their LL-37 peptide is synthesized using state-of-the-art technology and verified for purity—often exceeding 98% purity levels—to ensure accurate and reproducible results in experimental settings.

Researchers appreciate LeoLabRx for its commitment to transparency and compliance. Each peptide batch is accompanied by a certificate of analysis (CoA) confirming its identity, purity, and composition. This attention to quality assurance helps laboratories maintain consistency in their scientific studies and supports reliable data generation.

In addition to quality, LeoLabRx.com offers convenience and reliability for U.S.-based customers. With fast domestic shipping, secure packaging, and responsive customer service, researchers can expect timely delivery and professional support throughout the ordering process. Whether conducting preclinical trials, molecular biology research, or immune function studies, LeoLabRx provides the confidence and consistency scientists need when sourcing LL-37 peptide online in the USA.

LL-37 Dosage and Price

When purchasing the antimicrobial peptide LL‑37 online for research purposes, it is important to understand both the typical dosage ranges used in laboratory settings and the pricing you may encounter. Please note: these products are intended for research use only and are not approved for human or veterinary consumption.

---

Typical Research Dosage & Handling

• In many in vitro research protocols, LL-37 is supplied as a lyophilized (freeze-dried) powder, often in vials of 5 mg or 10 mg.
• A common approach: reconstitute the lyophilized peptide with sterile water, PBS (phosphate-buffered saline), or another appropriate buffer to achieve a stock concentration (for example, 0.1–1 mg/mL) depending on the experiment.
• From the stock solution, further dilutions are made for cell culture, tissue assays, or other in vitro models; the exact working concentration depends on the experimental design (e.g., antimicrobial challenge studies, wound-healing assays, immune-modulation experiments).
• Storage guidance: once reconstituted, the peptide is typically stored in aliquots at –20 °C or lower, avoiding repeated freeze–thaw cycles. The lyophilized powder is kept sealed, in a dry, low-temperature environment to maintain stability.
• Again, emphasising: LL-37 is for laboratory research only — it is not a dietary supplement, drug, or for human use.

LL-37: Pick the Right Vial

Any peptide, including LL-37, should be used within 4 weeks (ideally) and no longer than 6 weeks, as its potency cannot be guaranteed beyond this period.

With this in mind, I’ve created a table to help you select the right peptide vial based on three key criteria:

• Your weekly dosage
• The strength of the vial
• The optimal cost per month

This way, you can make an informed decision that balances effectiveness, convenience, and value.

Dosage	Price at LeoLabRx (USD)	Suitable For	Approximate Monthly Course Cost (USD)¹
5 mg	$90.00 (example for 5 mg vial)	Entry-level research use; one vial covers ~1 month of standard lab-usage	$90.00
10 mg	$170.00 (estimated double of 5 mg)	Larger studies or extended use; two-week supply per vial if higher dosage	$170.00

---

Example Pricing & Discount Structure

While direct pricing from LeoLabRx (leolabrx.com) was not found publicly with specific LL-37 price listings at the time of writing, comparable US research-peptide suppliers provide useful benchmarks:

• One vendor lists LL-37 (5 mg) at US $90.00 for a single vial, with incremental discounting: buy 3 and save ~4% ($87 each), buy 5 for ~$85 each, buy 10 for ~$80 each.
• Another supplier offers LL-37 (5 mg) at US $65.70, with tiered discounts: 10% off when purchasing 5-9 units ($59.13 each), 15% off at 10-24 units ($55.85 each) etc.
• A third source shows a 5 mg vial priced at US $49.99, with bulk discounts (e.g., 10% off for 5 + vials, 20% off for 10 + vials).

From these examples, you can anticipate that LeoLabRx might offer LL-37 in the ballpark of US $80-$90 for 5 mg, with volume discounting available.

---

Clarification on Use & Compliance

• It is critical to reiterate: LL-37 from suppliers such as LeoLabRx and others is labelled for “research use only (RUO)”. It is not approved by regulatory bodies like the Food and Drug Administration (FDA) for diagnostic, therapeutic, human, or animal use.
• Users must comply with institutional guidelines (e.g., IRB for human-adjacent work, IACUC for animal studies) and ensure proper lab protocols are followed.
• Ensure that every vial includes or is accompanied by a Certificate of Analysis (CoA) showing purity, identity, and batch information — this enhances reproducibility and quality assurance.

How to Save When You Buy LL-37 Online

When sourcing the peptide LL‑37 in the USA, it’s wise to look beyond just the base price and use smart purchase strategies to reduce your overall cost. Here are the two main savings methods you should use:

---

1. Quantity-Based (Bulk) Discounts at Checkout

Many trusted suppliers, including LeoLabRx (via leolabrx.com), automatically apply tiered discounts when you add multiple vials to your cart. The logic is simple: buy more units in one order ⇒ lower cost per unit.
For example:

• Adding 2 or more vials may drop the price per vial by several percent.
• Larger quantity orders (5, 10+ vials) often unlock deeper discounts.
  The exact discount rate depends on the supplier’s current pricing policy and inventory levels, so before you purchase, check how many vials trigger the next discount tier.

---

2. Exclusive Promo Code: “HCS-P1-10”

In addition to bulk discounts, you can apply an exclusive promo code from HCS‑Pharma: HCS-P1-10. This code provides an extra 10% off your entire order (vials + shipping + accessories) when entered at checkout.
Because this discount stacks on top of the bulk discount, you can significantly reduce the effective cost per vial.

---

Suggested Savings Strategy

• Decide how many vials you need for your study/project.
• Add that quantity to the cart at LeoLabRx and observe the automatic bulk discount.
• At checkout, enter the promo code HCS-P1-10 to apply the extra 10% off.
• Compare the final per-vial cost vs ordering fewer vials (or without the promo code) to ensure you’re getting the best value.
• Always double-check the final total before confirming your order.

Independent Laboratory Testing

Third-party testing is the gold standard for confirming an LL-37 peptide’s purity, identity, and safety profile before it’s used in experiments. Reputable suppliers commission accredited, independent labs (ideally ISO/IEC 17025) to run orthogonal analytical methods and issue a batch-specific Certificate of Analysis (CoA) tied to the vial’s lot number.

What tests you should expect to see:

• Identity confirmation
  • High-resolution MS (LC-MS, MALDI-TOF) to verify molecular weight and detect truncations or sequence errors.
  • Optional MS/MS peptide mapping to confirm the LL-37 sequence.
• Purity assessment
  • RP-HPLC chromatogram reporting % area purity (research grade is typically ≥98%).
  • Capillary electrophoresis (optional) as an orthogonal purity check.
• Content & composition
  • Amino acid analysis (AAA) or UV quant to quantify peptide content.
  • Counter-ion / salt analysis (e.g., TFA content), water content (Karl Fischer), and residual solvent screening (GC).
• Safety & quality indicators
  • Endotoxin testing (e.g., USP <85> LAL assay) with limits appropriate for research.
  • Microbial limits / sterility testing when applicable (e.g., USP <61>/<62>/<71> for sterile formats).
  • Heavy metals (ICP-MS) where relevant.

Why independent verification matters:
Third-party data helps you avoid false positives, irreproducible results, and contamination-driven artifacts. Independent CoAs reduce the risk of lot-to-lot variability, confirm you’re working with the correct, intact 37-aa sequence, and protect your downstream assays (wound-healing, immunomodulation, biofilm models) from purity-related confounders.

How to vet a CoA (quick checklist):

1. Lot/Batch Number matches your vial label.
2. Methods listed (LC-MS, HPLC) with instrument/model and conditions summarized.
3. Raw outputs attached or referenced (chromatogram, mass spectrum).
4. Numerical results (purity %, measured MW, endotoxin EU/mg, water %, residual solvents).
5. Accreditation details (lab name, ISO/IEC 17025 if applicable, analyst sign-off and date).

Conclusion

LL-37 continues to capture the attention of scientists and medical researchers due to its broad biological significance and therapeutic potential. As a powerful antimicrobial and immunomodulatory peptide, LL-37 plays a vital role in protecting the human body, promoting wound healing, and regulating inflammatory responses. Its versatility makes it one of the most studied peptides in modern research, with ongoing investigations into its use in infection control, tissue regeneration, and immune system modulation.

For those looking to buy LL-37 online in the USA, LeoLabRx.com stands out as a trusted supplier offering research-grade peptides that meet high standards of purity, consistency, and laboratory compliance. Their antimicrobial peptide is manufactured under strict quality control and backed by Certificates of Analysis to ensure authenticity and reliability.

When purchasing, take advantage of quantity-based discounts and apply the exclusive promo code “HCS-P1-10” from HCS-Pharma to save an additional 10% at checkout. This combination allows researchers to minimize costs without compromising product integrity.

Ultimately, sourcing LL-37 from reputable U.S.-based suppliers like LeoLabRx ensures that your research materials are pure, verifiable, and handled with the professional care required for precise scientific studies. Always prioritize quality and transparency when purchasing peptides online — your research results depend on it.

LL-37 Peptide — Frequently Asked Questions (FAQ)